Hydrolysis raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-08-21. Anything still debated is marked as such rather than presented as settled.
Reconstitution introduces new risks because the peptide contacts solvent, air, and container surfaces. The chosen solvent should match the peptide's solubility profile, and buffer salts, pH, and ionic strength can affect dissolution and subsequent stability. Gentle mixing is preferred over vigorous vortexing, which can create interfaces and shear. If the solution is not clear, the cause may be incomplete dissolution, aggregation, or insoluble counter-ions rather than a simple concentration problem. Filtration is sometimes used, but filters can adsorb peptides and alter measured concentration.
Cold-chain practice relies on documented temperature ranges, calibrated monitoring, and minimized excursions. Shipments may use insulated boxes, phase-change materials, or dry ice, with data loggers to record conditions. Upon receipt, the recipient should verify the logger trace and place items into long-term storage promptly. Repeated warming and cooling during transfers can be more harmful than a single controlled excursion. For solutions, dividing material into single-use aliquots reduces the number of thawing and refreezing events and limits repeated opening of the same container.
Light exposure can damage aromatic residues and certain labels, so amber vials or opaque containers are often used. pH control matters in solution, as extreme acidity or alkalinity accelerates backbone cleavage; buffers may also introduce ions that affect solubility. Microbial growth is a concern for aqueous preparations that lack preservatives, though many research peptides are handled in sterile or low-bioburden conditions. Container materials can adsorb peptides, particularly hydrophobic or positively charged sequences, reducing recovery. These factors interact, meaning storage decisions balance chemical stability, physical state, and intended use.
Peptides are short chains of amino acids whose physical and chemical stability depends on sequence, length, and conformation. The amide backbone can hydrolyze under acidic or basic conditions, while side chains such as methionine, cysteine, and tryptophan are prone to oxidation. Aggregation may occur when hydrophobic regions associate, especially near surfaces or at high concentration. Because these pathways differ among peptides, no single storage condition applies to all sequences. Stability studies therefore examine each peptide under defined temperature, pH, and humidity ranges.
| Property | Value | Notes |
|---|---|---|
| Container material | Glass or polypropylene | Low-binding options reduce peptide adsorption |
| Typical shipping condition | Dry ice or gel packs | Choice depends on required temperature range |
| Light protection | Amber vial or foil wrap | Reduces photodegradation of sensitive residues |
| Reconstitution solvent | Water, buffer, or organic co-solvent | Depends on peptide solubility and assay requirements |
| Temperature monitoring | Data logger or indicator | Documents excursions during transport and storage |
After reconstitution, solutions are usually divided into single-use aliquots to avoid repeated freeze-thaw cycles. Aliquots should be labeled with peptide identity, concentration, solvent, and date, then stored at the temperature specified by the supplier or protocol. Many peptides tolerate -20 °C for short periods, while -80 °C is preferred for longer storage. Frost-free freezers are generally avoided because temperature fluctuations can stress samples. Aseptic technique and sterile filters reduce microbial contamination, though filtration can also remove aggregated material or bind some peptides.
Peptide handling begins with careful receipt and inventory. Containers should be inspected for damage, label information should match the certificate of analysis, and storage location should be recorded. Many lyophilized peptides are electrostatic and may cling to vial walls or weighing paper, which can complicate transfer. Allowing a cold vial to equilibrate to room temperature before opening reduces condensation on the contents. Clean tools, gloves, and a low-humidity workspace limit contamination and moisture exposure during manipulation.
Light, oxygen, and pH influence peptide integrity through specific side-chain reactions. Methionine and cysteine residues are susceptible to oxidation, and tryptophan can degrade under strong light. Inert gas overlays and amber glass or opaque containers reduce these risks. pH affects charge, solubility, and the rate of deamidation or aggregation; a value that minimizes one pathway may increase another. The optimal pH and buffer for a given peptide are often determined experimentally, and open questions remain about predicting stability from sequence alone.
Peptides are short chains of amino acids linked by amide bonds, and their storage stability depends on sequence, length, and three-dimensional structure. Chemical degradation can occur through hydrolysis, oxidation, deamidation, and aggregation, while physical changes such as precipitation or surface adsorption reduce recovery. Storage conditions are chosen to slow these processes without altering the peptide itself. Because peptides vary widely, no single condition suits every sequence, so laboratories often establish stability empirically for each batch.
Temperature is a primary factor because most degradation reactions proceed more slowly at lower temperatures. Lyophilized peptides are commonly held at -20 °C or below, although some sequences remain stable at 2–8 °C for limited periods. Moisture uptake during handling can accelerate hydrolysis, so sealed containers and desiccants are used. Solutions are generally less stable than powders and may require freezing at -80 °C or refrigeration, depending on the peptide. Repeated freeze-thaw cycles can promote aggregation even when the storage temperature is otherwise suitable.
Reconstitution introduces new variables. The solvent should match the peptide's solubility profile, and water or buffer quality matters because trace metals and microbes can alter results. Adding solvent gently down the vial wall minimizes foaming, which can denature some sequences. Mixing by gentle inversion or swirling is usually preferred over vigorous vortexing. If a peptide does not dissolve readily, adjusting pH or using a small amount of organic co-solvent may help, but such steps can also affect stability and should be documented.
Quality control links handling to measurable identity and purity. Reverse-phase high-performance liquid chromatography can separate peptide variants and reveal impurities. Mass spectrometry confirms molecular mass and can detect truncations or modifications. These methods are often paired with ultraviolet absorbance or amino acid analysis for concentration. Documentation of instrument settings, column type, and reference standards supports reproducibility. For research materials, acceptance criteria depend on the intended application, and no universal purity threshold applies to all peptides.
Handling begins when a peptide container is opened. Hygroscopic solids can absorb atmospheric water rapidly, so bench work should be brief and containers resealed with fresh desiccant. Weighing or transferring should occur in a low-humidity environment where possible. Static electricity may cause fine powders to cling to surfaces, leading to inaccurate mass measurements. Tools such as antistatic devices or grounded workstations reduce that problem. Good laboratory practice also includes labeling date, lot, and storage condition after each opening.
In physics and chemistry, binding energy is the smallest amount of energy required to remove a particle from a system of particles or to disassemble a system of particles into individual parts. In the former meaning the term is predominantly used in condensed matter physics, atomic physics, and chemistry, whereas in nuclear physics the term separation energy is used. A bound system is typically at a lower energy level than its unbound constituents. According to relativity theory, a ΔE decrease in the total energy of a system is accompanied by a decrease Δm in the total mass, where Δmc2 = ΔE. There are several types of binding energy, each operating over a different distance and energy scale. The smaller the size of a bound system, the higher its associated binding energy.
2,5-Diketopiperazine is an organic compound with the formula (NHCH2C(O))2. The compound features a six-membered ring containing two amide groups at opposite positions in the ring. It was first compound containing a peptide bond to be characterized by X-ray crystallography in 1938. It is the parent of a large class of 2,5-Diketopiperazines (2,5-DKPs) with the formula (NHCH2(R)C(O))2 (R = H, CH3, etc.). They are ubiquitous peptides in nature. They are often found in fermentation broths and yeast cultures as well as embedded in larger more complex architectures in a variety of natural products as well as several drugs. In addition, they are often produced as degradation products of polypeptides, especially in foods and beverages. They have also been found in extraterrestrial objects such as comets and asteroids.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
In addition to cell signaling, the mTOR pathway also plays a role in beta cell growth leading to insulin secretion. High glucose in the blood begins the process of the mTOR signaling pathway, in which leucine plays an indirect role. The combination of glucose, leucine, and other activators cause mTOR to start signaling for the proliferation of beta cells and the secretion of insulin. Higher concentrations of leucine cause hyperactivity in the mTOR pathway, and S6 kinase is activated leading to inhibition of insulin receptor substrate through serine phosphorylation. In the cell the increased activity of mTOR complex causes eventual inability of beta cells to release insulin and the inhibitory effect of S6 kinase leads to insulin resistance in the cells, contributing to development of type 2 diabetes. Metformin is able to activate AMP kinase which phosphorylates proteins involved in the mTOR pathway, as well as leads to the progression of mTOR complex from its inactive state to its active state. It is suggested that metformin acts as a competitive inhibitor to the amino acid leucine in the mTOR pathway.
Most atomic nuclei contain protons and neutrons. The number of protons determines the chemical element the nucleus belongs to. Different isotopes of the same element have different numbers of neutrons in their nuclei, but contain the same number of protons. For example, isotopes of carbon include carbon-12, carbon-13, carbon-14, which contain 6, 7, 8 neutrons respectively, but all contain 6 protons. Each isotope of an element has a different nuclear energy state, and may have different stability.
Sources: en.wikipedia.org
Passive immunity is the immunity acquired by the transfer of ready-made antibodies from one individual to another. Passive immunity can occur naturally, such as when maternal antibodies are transferred to the foetus through the placenta, and can also be induced artificially, when high levels of human (or horse) antibodies specific for a pathogen or toxin are transferred to non-immune individuals. Passive immunization is used when there is a high risk of infection and insufficient time for the body to develop its own immune response, or to reduce the symptoms of ongoing or immunosuppressive diseases. Passive immunity provides immediate protection, but the body does not develop memory, therefore the patient is at risk of being infected by the same pathogen later.
Essentially all of the studies on 5-oxo-ETE's activities and target cells, similar to those on other members of the 5(S)-HETE family of agonists, are best classified as pre-clinical development studies: they have not yet been determined to be important in human pathophysiology. Translation studies are needed to learn if the preclinical studies implicating 5-Oxo-ETE and other 5(S)-HETE family members in allergic diseases, inflammatory diseases, cancer, steroid production, bone remodeling, parturition, and other pathophysiological events, as outlined here and on the 5-HETE page, are relevant to humans and therefore of clinical significance.
H3O+(aq) + OH−(aq) ⇌ H2O(liq) + H2O(liq) Due to this equilibrium, any increase in the concentration of hydronium is accompanied by a decrease in the concentration of hydroxide. Thus, an Arrhenius acid could also be said to be one that decreases hydroxide concentration, while an Arrhenius base increases it. In an acidic solution, the concentration of hydronium ions is greater than 10−7 moles per liter. Since pH is defined as the negative logarithm of the concentration of hydronium ions, acidic solutions thus have a pH of less than 7.
It might occur either at the enzyme or receptor level. There are two possible outcomes at the enzyme level: competitive inhibition or enzyme activity reactivation. Ethyl alcohol or fomepizole used in methyl alcohol or ethylene glycol poisoning is a typical example of competitive enzyme inhibition. By posing competition for alcohol dehydrogenase (ADH) with methyl alcohol and ethylene glycol, these drugs reduce the production of harmful metabolites. For receptor level, the traditional antidotes include naloxone and flumazenil. Flumazenil functions as a competitive antagonist at the GABA-A receptor complex's benzodiazepine site. By doing this, the CNS and respiratory depression would reverse and the inward chloride current would reduce. Flumazenil is useful in treating and preventing benzodiazepine-induced coma from recurring.
Possibly the most common use of affinity chromatography is for the purification of recombinant proteins. Proteins with a known affinity are protein tagged in order to aid their purification. The protein may have been genetically modified so as to allow it to be selected for affinity binding; this is known as a fusion protein. Protein tags include hexahistidine (His), glutathione-S-transferase (GST), maltose binding protein (MBP), and the Colicin E7 variant CL7 tag. Histidine tags have an affinity for nickel, cobalt, zinc, copper and iron ions which have been immobilized by forming coordinate covalent bonds with a chelator incorporated in the stationary phase. For elution, an excess amount of a compound able to act as a metal ion ligand, such as imidazole, is used. GST has an affinity for glutathione which is commercially available immobilized as glutathione agarose. During elution, excess glutathione is used to displace the tagged protein. CL7 has an affinity and specificity for Immunity Protein 7 (Im7) which is commercially available immobilized as Im7 agarose resin. For elution, an active and site-specific protease is applied to the Im7 resin to release the tag-free protein.
Sources: en.wikipedia.org
GeneReviews/NCBI/NIH/UW entry on APC-Associated Polyposis Conditions OMIM entries on APC-Associated Polyposis Conditions[link removed] Adenomatous+Polyposis+Coli+Protein at the U.S. National Library of Medicine Medical Subject Headings (MeSH) GeneCard Database concerning peer-reviewed reports on cancer critical alteration in several genes including (APC (protein)), (TP53), (Beta-catenin|β-catenin) Human APC genome location and APC gene details page in the UCSC Genome Browser.
Jonathan E. Mangum is an Australian biomedical scientist, entrepreneur, and executive known for his contributions to translational proteomics and the development of diagnostic technologies in oral health. He is a co-founder of Incisive Technologies and the scientific lead behind BlueCheck, a diagnostic tool for early detection of dental caries, which received FDA clearance in 2023. Mangum earned his Bachelor and Master of Science degrees in Biochemistry from the University of Otago in New Zealand (1995–2000). He completed a PhD in Biomedical Sciences at the University of Melbourne in 2013. He also holds a Graduate Certificate in Commercialisation from Melbourne Business School.
Gingras research focuses on the development of experimental and bioinformatics approaches for functional proteomics, with a focus on protein-protein and proximity interactions. She applies these tools to the study of signaling pathways in health and disease and in mapping the physical organization of the dynamic proteome. Some of her work focuses on the consequence of disease-associated mutations on the interactions established by proteins. In addition to proteomics, Gingras laboratory has interest in studying human protein phosphatase and their systematic interactions and has now expanded into the field of systems biology.
Several artificial nucleobases have been synthesized, and successfully incorporated in the eight-base DNA analogue named Hachimoji DNA. Dubbed S, B, P, and Z, these artificial bases are capable of bonding with each other in a predictable way (S–B and P–Z), maintain the double helix structure of DNA, and be transcribed to RNA. Their existence could be seen as an indication that there is nothing special about the four natural nucleobases that evolved on Earth. On the other hand, DNA is tightly related to RNA which does not only act as a transcript of DNA but also performs as molecular machines many tasks in cells. For this purpose it has to fold into a structure. It has been shown that to allow to create all possible structures at least four bases are required for the corresponding RNA, while a higher number is also possible but this would be against the natural principle of least effort.
Enzyme specificity refers to the interactions between any particular enzyme and its corresponding substrate. In addition to the specificity in binding its substrates, correct proximity and orientation as well as binding the transition state provide an additional layer of enzyme specificity. Enzymes vary in the specificity of the substrates that they bind to, in order to carry out specific physiological functions. Some enzymes may need to be less specific and therefore may bind to numerous substrates to catalyze a reaction. On the other hand, certain physiological functions require extreme specificity of the enzyme for a single specific substrate in order for a proper reaction and physiological phenotype to occur. The different types of categorizations differ based on their specificity for substrates. Most generally, they are divided into four groups: absolute, group, linkage, and stereochemical specificity.
Sources: en.wikipedia.org
Allow the sealed vial to reach room temperature before opening to reduce condensation. Use a suitable solvent and gentle mixing rather than vigorous agitation. Follow the supplier's solubility information when available.
Aliquots limit repeated thawing and refreezing and repeated vial opening, both of which can promote degradation. They also reduce the chance of contaminating an entire batch. Single-use portions should be labeled with identity, concentration, solvent, and date.
Inspect the package for damage and confirm that temperature indicators or data loggers stayed within the specified range. Check the vial condition and labeling before placing it into storage. Record any excursion or discrepancy for the supplier or quality system.
Freezing slows hydrolysis and oxidation by reducing molecular motion and available water. Lyophilized powders contain little moisture, so they can remain stable for extended periods when kept cold and dry. The exact temperature depends on peptide sequence and expected storage duration.